پایان نامه ارشد درباره Sec.Cons.، Query، cs3_1، caf1M

دانلود پایان نامه ارشد

: SQLPTNLPLKFITTEGNEHLVSGNYRANITITST–IK
Caf1 : SQ—DFFVRSIGSKGGK-LAAGKYTDAVTVTVSNQ–
Cs3 Sec.Cons :cccccccceeeeeecccceeeccccceeeeeeee–cc

Caf1 Sec.Cons :cc—eeeeeeeccccce-eeeeeeceeeeeeeecc—
(a1)

10 20 30 40 50 60 70
| | | | | | |
cs3 AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGT
Sec.Cons. cccccchhhhhhhhcccc????ccccccceee?cccccceeeeeeeecccccceeeeeecccccccccce

caf1 ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPM
Sec.Cons. ccccccccceeeecccceeeee?cccc?eeee?cccccceeeeeeeeeccccccc???eee??cccccce

80 90 100 110 120 130 140
| | | | | | |
cs3 VTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANIT
Sec.Cons. eeeeecccccc?eeeeeccccc?eee?ccccceeeeeccccccccccc?eeeeccccc?ee?cccc?eee

caf1 YLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTD
Sec.Cons. eeeeeccccccceeeeeeeccccccccccccccccc?ccceeeeeccccceeeeecccccceeecccccc

cs3 ITSTIK
Sec.Cons. eeeeec

caf1 AVTVTVSNQ
Sec.Cons. eeeeee?ec

(a2)

10 20 30 40 50 60 70

| | | | | | |
cs3_1 NNITTQKFEAILGATRVIYHLDGNGESLRVKNPQISPILIQSKVMDEGSKDNADFIVTPPLFRLDAKRET
Sec.Cons. cccc??hhhhhhcceeeeee?ccccceeeecccccc?eeee?hhccccccccc?eeeccccccccccccc
caf1M ANSAQPDIKFASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPPL
Sec.Cons. cccccccceeccccc?eecccceeeeeccccceeeeeccccccceeee????ccccccccccceeecccc

80 90 100 110 120 130 140
| | | | | | |
cs3_1 DIRIVMVNGLYPKDRESLKTLCVRGIPPKQGDLWANNEKEFVGMKLNVSINTCIKLILRPHNLPKLDINS
Sec.Cons. ceeeeeeccccccc?hhhheeeeccccccccc??ccccc?cce?eee???ccceeeeeccccccc??ccc
caf1M FRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDEDIWVDDATNKQKFNPDKDVGVFVQFAINNC
Sec.Cons. ccccccc??hh??hhccccccccccceeeeeeccccccccceeeccccccccccccccc?eeeeee?cc?

150 160 170 180 190 200 210
| | | | | | |
cs3_1 EGQIEWGIRDGNLVAKNKTPYYFTIVNASFNGKALKTPGTLGPYEQKLYTLPSKISVSGLVKWEIIGDLG
Sec.Cons. ccceeeeeccccee?ccccceeeeeeecccccccccccccccccccceeeccccee?cc?eeeeeeeccc
caf1M IKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKG
Sec.Cons. eeeeeccccccccch??hh??ee??ccceeeeccccceeeeec?ee?cccccccccccccc??ee?cccc

220
|
cs3_1 ESSETKKFNI
Sec.Cons. ccccccceec
220 230
| |
caf1M LAGARNVSWRIINDQGGLDRLYSKNVTL
Sec.Cons. cccccc?eeeeeccccccceeecccc?c
(a3)

(B):
1p5v,chainB

d1p5vb_.1phyre2

CS3-1 Swiss-model
(b1)

1P5U chain A

(b2)
(C):

(C1) (C2)
شکل (3-4 ): همردیفی توالی- ساختاری بین پروتئینهای الگو-هدف(a ) نتیجه همردیفی توالی آمینواسیدی CstH (هدف) با caf1(الگو); ملکولهای هم ردیف شده دارای 25%همسانیت توالی، 1/53% تشابه، عدم انطباقهایی که در همردیفی توالی مشاهده میشود در همردیفی ساختار دوم نیز قابل مشاهده است، خط پیوند (“-“) نشاندهنده افتادگی در یک بنیان است.(a2) ، مقایسه ساختار دوم توافقی بین الگو – هدف (ساختار دوم توافقی استخراج شده از متدهای تعیین ساختار دوم یعنیGOR4, PHD, SIMPA96 و SOPM میباشد): عناصر ساختار دوم پروتئین با حروف h helix, ،e ، extended، و c،coil. نشاندادهشدهاست.
(B ) تعیین ساختار دوم برای مدلهای پیشنهادی و الگوهای مربوطه با نرمافزار Stride و مقایسه آنها، نوار آبی رنگ = هلیکسها، میلههای زرد رنگ =کویلها و فلشهای سبز= استرندها.
(C ) تصاویری از مقایسه ساختاری، مناطقی که به دلیل تفاوت ساختاری غیرقابل انطباق هستند با رنگ قرمز و زرد تیره به ترتیب برای مدلهای CS3-1 و CstH نشانداده شدهاند.

Score = 164 bits (414), Expect = 4e-41, Method: Compositional matrix adjust.
Identities = 84/218 (39%), Positives = 132/218 (61%), Gaps = 11/218 (5%)

Query 3 ITTQKFEAILGATRVIYHLDGNGESLRVKNPQISPILIQSKVMDEGSKDNAD–FIVTPP 60
++++ +G +R+IY LD G + VKN Q P+LIQS++ DE + ++ F+VTPP
Sbjct 7 FASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPP 66

Query 61 LFRLDAKRETDIRIVMVNGLYPKDRESLKTLCVRGIPPKQGDLW—ANNEKEF—–V 112
LFRLDAK++ +RI G++P+D+ESLK LCV+GIPPK D+W A N+++F V
Sbjct 67 LFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDEDIWVDDATNKQKFNPDKDV 126

Query 113 GMKLNVSINTCIKLILRPHNLPKLDINSEGQIEWGIRDGNLVAKNKTPYYFTIVNASFNG 172
G+ + +IN CIKL++RP+ L I + W + G L+A+N +P+Y I +F G
Sbjct 127 GVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGG 186

Query 173 KALKTPGTLGPYEQKLYTLPSKISVSGLVKWEIIGDLG 210
K++ + + P + LP ++ + V W II D G
Sbjct 187 KSIPS-HYIPPKSTWAFDLPKGLAGARNVSWRIINDQG 223

(A)

Phyre 2

cs3
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTG-V-SNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGT-VTFAHETNNSASFAT-TISTDNANITL—— DKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITST–IK
d1p5v_b
————–VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTS-TSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLAT-GSQ—DFFVRSIGSKGGK-LAAGKYTDAVTVTVSNQ—
(B)
شکل3-5. (A) و ((B همردیفی توالی الگو و هدف زیرواحد اصلی و چاپرون دو پیلی CS3 و F1 antigen که به ترتیب توسط سرورهای سازنده مدل یعنی Swiss-M0del و Phrye2 ارائه شدهاست.

جدول 3-2. ویژگیهای ساختاری الگو- هدف که توسط روشهای محاسباتی به همراه امتیازات نمرهدهی بدست آمدهاست.

Query

Template

Methods

%id

Modelled reagions

Scores

CE

TM-align

Deepview

Sizef RMSD
size RMSD
size RMSD

Cs3
d1p5vb

d1p5vb
Phyre2

Fold pro
26
15-142
89%a

0.94b

114 1.0 A

مدل بررسی نشد
125 1.39 A°

مدل بررسی نشد
114 0.56 A°

مدل بررسی نشد
Cs3-1
1p5uA

1p5uA

1p5uA

Swiss-model

Blast against PDB

Psi-Blast against PDB
37.5

39

38
5 to 220
cQMEANscore4= 0.58
E-valued= 0.00e-1

E-valuee
= 4e-41

E-value

= 4e-69

205 0.9 A

مدل ارائه نشد

مدل ارائه نشد
205 1.13

مدل ارائه نشد

مدل ارائه نشد
197 0.17 A°

مدل ارائه نشد

مدل ارائه نشد
Score a امتیاز بالاتر نشاندهنده اعتبار بالایی مدل ساخته شده میباشد.
Score b: امتیاز مثبت نشاندهنده انطباق معنیدار بین توالی کوئیری- الگو میباشد.
QMEANscore4c <1 <1: از درجه اعتماد بالایی برخورداراست.
E-valued <001/.: بسیار معنیدار و مطمئن
E-value e: هر جه پایین تر باشد قابل اطمینانتر است.
Size f: نشاندهنده تعداد موقعیتهایی که همردیف شدند.

2-2-1-3 تولید و ساخت مدل و ارزیابی کیفیت آنها
ترکیبی از همردیفی ساختارهای اول، دوم و سوم برای مدلسازی ساختارهای CstH و CS3-1 استفادهشد. ساختارهای سوم Caf1 (PDB id 1p5v; chainb) و Caf1M (PDB id 1p5u; chainA) به عنوان مناسبترین ( پربرخوردترین الگو) الگو برای مدلسازی دو پروتئین به ترتیبCstH و CS3-1 توسط سرورهای مختلف ارائه شدند و مدلهای ساخته شده (شکل 3-6) برای دو ملکولCstH و CS3-1، در شرایط دینامیک ملکولی با نرم افزار گرومکس در دمای 300 درجه کلوین و فشار یک بار برای 23 نانوثانیه شبیهسازی شدند همچنانکه در شکل 3-7 ملاحظه میشود ملکول چاپرون پایداری مطلوبی بعد از 23 نانوثانیه بدستآوردهاست ولی ملکولCstH دارای آشفتگی در انتهایآمینی خود میباشد.
لذا مدلهای حاصل از روشهای استاتیک جهت تائید بیشتر توسط نرمافزارها و ابزارهای ارزیابی مانند سرورهای,Veryfy3D, Qmean ,Prosa-web TM-Scoreو نمودار راماچاندران مورد ارزیابی قرارگرفتند.

شکل .3-6. مدلهای تولید شده برای دو پروتئین CstH (سمت چپ) و CS3-1 (سمت راست) به ترتیب با Alignment – Mode Swiss-Model و Modeler.

شکل 3-7. ارزیابی پایداری دو ملکول CstH وCS3-1 در طی شبیهسازی دینامیک ملکولی. (A) RMSF97 برای ملکول CstH و (B) RMSD برای ملکول CS3-1

امتیاز حاصل از سرور Verify3D برای مدل CstH (d1p5vb) بیشتر از صفر میباشد و برای مدل CS3-1 امتیاز در مناطق کوچکی زیر صفر افت پیدا میکند (100-113) که این مناطق هم از لحاظ سرهمبندی زیرواحدهای پیلی نقش چندان کلیدی ندارد و بررسی بیشتر با سایر ابزارها برای پاسخگویی و رفع این نقیصه انجام گرفت .
بررسی نمودار راماچاندران نشان داد که به ترتیب 82% و 92% اسیدهایآمینه مدل برای CstH و CS3-1 در منطقه بسیار مطلوب قرار دارند (شکل3-8) که نشاندهنده صحت مدلهای تولید شده میباشد.
آنالیز مدل های CstH و CS3-1 بوسیله سرور Qmean امتیازات 42/.و658/.را نشانداد و Z-score سرور تحت شبکه Prosa به ترتیب 65/2-و 86/4- میباشد که این امتیاز در محدوده NMR و آرایشهای طبیعی میباشد و بدین ترتیب تائیدی بر مدلهای ارائه شده میباشد(جدول 3-2).

(a1) (a2)
(a)

(b1) (b2)
(b)

شکل 3-8. (a) بررسی کیفیت مدلهای (a1 و a2) CstH و (b و d) cs3-1توسط سرور تحت شبکه Prosa و(b) نقشه راماچاندران با سرور Procheck، همچنانکه نتیجه بررسی در سرور Prosa نشان میدهد مدلهای حاصل ازلحاظ کیفیت ساختاری هم سطح با ساختارهای تعیین شده با NMR میباشند و همچنین نقشه راماچاندران حاصل حاکی از کیفیت بالای مدل تولید شده برای cs3-1(b1) و کیفیت قابل قبول مدل(b2) CstH میباشد.

پس از پیشگویی ساختارهای سوم زیرواحد اصلی و چاپرون پیلی CS3 آنالیز و بررسیهای بیشتری بر روی مدلCstH جهت پیشگویی و یافتن جایگاههای مجاز انجام گرفت که ادامه مراحل و نتایج آن بشرح زیر میباشد.

3-2-1-3 سطوح قابل دسترس و اسیدهایآمینه سطحی
علم و آگاهی بر مناطق سطحی ودر دسترس ((98ASA پروتیئن بعبارت دیگر اسیدهایآمینه در دسترس حلال در مکانیابی کاندید جایگاههای مجاز از اهمیت بالای برخورداراست. ابزارهای متعددی جهت پیشگویی و تعیین ASAبر اساس توالیهای اولیه و ساختارهای سوم توسعه یافته است. ابزار prot-scale در وب سایت expasy با پنجره کوچک به طول 9 اسیدآمینه، گرافی را براساس آب دوستی Kyte & Doolittle برای ساختار اولیه CstH نشانداد که چندین جایگاه به عنوان کاندیدای جایگاه مجاز انتخاب شدند (شکل 3-9).

شکل 3-9. کاندیداهای جایگاههای مجاز. جایگاههایی که امیتاز آنها کمتر از 0 میباشد بعنوان کاندید جایگاه مجاز میباشند، موقعیتهای که در این مطالعه به عنوان جایگاه مجاز انتخاب شدند با بیضیهای سیاه رنگ نشان داده شدهاست.

برای افزایش سندیت و اعتبار نتایج، کیفیت پیشگویی مناطق سطحی و در دسترس با کمک نرمافزار Discovery Studio و برنامه هایGetarea و Vadarمورد ارزیابی قرار گرفتند. برنامههای فوق مناطق پنهان، در معرض قطبی و باردار را ارائه میکنند همچنانکه در شکل 3-10 ملاحظه میشود بخش بزرگی از ملکول در دسترس حلال بعبارتی در معرض قرار میگیرند. در آنالیز بابرنامههایGetarea و Vadarمناطقی که میزان در سطح قرار گیری آنها بیش از 50 درصد بدست آمدند بعنوان مناطق در دسترس (ASA) و جایگاههای مجاز احتمالی در نظر گرفتهشدند. مقایسه مناطق فوق با مناطقی که در بررسی آب دوستی پروتئین به عنوان کاندید جایگاهمجاز در نظر گرفتهشدهبود نشان میدهد که این نواحی بر یکدیگر منبطق هستند (شکل 3-11).

شکل 3-10. آنالیز در معرض قرارگیری مدل CstH با کمک نرمافزارDiscovery Studio 2.5. مناطق در معرض با رنگ سیاه و مناطق مخفی با رنگ زرد نمایش دادهشدهاست.

شکل 3-11. آنالیز مدل CstH با سرور VADAR. جایگاههای مجاز با پیکان نمایش دادهشدهاست.

4-2-1-3 سطوح مشترک و اسیدهایآمینه درگیر در ارتباطات زیرواحدها در پلیمر پیلی و زیرواحد–چاپرون
پیلی باکتریایی پلیمری است که از زیرواحدهای یکسان تشکیل شدهاست که طی مراحل اسمبلی یا سرهم شدن به صورت یک به یک به پلیمر اضافه شده تا پلیمر پیلی که حدود 500 زیرواحد دارد تشکیلشود. زیر واحدهای پیلی قبل از اینکه وارد پلیمر شوند، کمپلکسهای موقتی با چاپرون در پریپلاسم تشکیل میدهند. سپس طی فرایند سرهم شدن و تشکیل پلیمر، چاپرون با زیرواحد جابجا میگردد (شکل 1-7). بنابراین بنظر میرسد مناطق درگیر در فرایند اسمبلی پیلی و نیز مناطق در ارتباط با اتصال زیرواحد–چاپرون میبایست مشخص شده تا از دستکاری ژنتیکی استثنا شوند. در اینجا با بکارگیری سه روش زیر، توالی های درگیر در ارتباطات و اتصالات پیشگویی شدند (جدول3-3).
(a): دو سرور پیشگویی برهم کنش پروتئین-پروتئین یعنی Pcons-PPISP و Meta-PPISP جهت پیشگویی بنیانهای درگیر در اتصالات بر اساس مدل CstH استفاده شدند و نتایج حاصل حاکی از این است که جایگاههای پیشنهاد شده جهت پذیرش پپتید بیگانه (جایگاههای مجاز) در واکنش پروتئین- پروتیئن شرکت نمیکنند(پیوست هفت).
( B): در روش دوم، مناطق مرتبط از طریق دیاگرام برهمکنش پروتئین-پروتئین موجود در PDBsum برای ورودیهای 1p5v و 1p5u استخراج شد و موقعیت نسبی آنها بر روی پروتئینهای CstH و CS3-1 بعنوان مناطق احتمالی درگیر در اتصالات ملکولی از دستورزی مستثنی شدند. آدرس دسترسی به محلهای درگیر در اتصالات ملکولی دو پروتئین Caf1 و Caf1M (به ترتیب الگوهای CstH وCS3-1) به شرح زیراست.
http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetIface.pl?pdb=1p5v&chain1=A&chain2=B
(c ): از آنجائیکه دو سیستم CS3 و Caf شباهت زیادی با هم دارند بنابراین بنظر میرسد که آنالیز و بررسی سیستم Caf از نقطه نظر اسیدهایآمینه درگیر در اتصالات میتواند به سیستم CS3 نیز تعمیم دادهشود. بنابراین اسیدهایآمینه درگیر درهمودایمر(Caf1::Caf1) و هترودایمر (Caf1::Caf1M) سیستم Caf با کمک محاسبه میزان تغییر در مناطق قابل دسترس (ΔASA) از حالت منومری نسبت به حالت دایمری با کمک سرور Getarea ارزیابیشد و اسیدهایآمینه با ΔASA <0 Å به عنوان بنیانهای درگیر در اتصالات در نظر گرفتهشدند (دادهها نمایش داده نشدند).
و بدین ترتیب، بنیان های در ارتباط بین زیرواحد-زیرواحد و زیرواحد-چاپرون پیشگویی شدند و براساس این نتایج حدود 25 اسیدآمینه از ابتدا و انتهای زیرواحد و تعداد کمی در طول پروتئین CS3 در این ارتباطات درگیر میباشند و از دستکاری ژنتیکی کنارگذاشته شدند.

جدول 3-3. مناطق و اسیدهایآمینه درگیر در ارتباطات ملکولی و غیرقابل دسترس ملکول CstH

5-2-1-3 پیشگویی و تعیین ساختار دوم
ساختارهای دوم و نیز ساختار دوم توافقی توالی زیرواحد اصلی پیلیCS3 (جدول شماره 1) با نرمافزارهای مختلفی که در بخش مواد و روشها به آنها اشاره شد، پیشگویی گردید.
روش های پیشگویی ساختار دوم بخصوص زمانی که همراه با دیگر روش های آنالیز بکار میروند، بسیار مفید میباشند، به عنوان مثال در مواردی که الگوهای پیشگویی شده از لحاظ توالی، تشابه کمتری باهم دارند در این مواقع پیشگویی ساختار دوم می تواند در گزینش الگوی مناسب که دارای ساختار مشابه با پروتئین هدف می¬باشد کمک کند.
از طرف دیگر تصور می‌شود نواحی در معرض محیط99 و آب دوست که ساختار کویل نیز دارند کاندیدای مناسبی‌، برای مناطق مجاز و وارد کردن پپتیدهای بیگانه جهت عرضه سطحی هستند. (,Hedegaard.1989 Macdonald.2001، chlehuber.2004 و Sujatha.2006). لذا ساختار دوم پروتئین CstH توسط نرمافزارهای پیشگویی و نرم افزارهای تعیین ساختار دوم به ترتیب از ساختار اولیه و مدل CstH جهت بدست آوردن مناطق دارای آرایش کویل مورد بررسی قرار گرفتند( شکلهای 3-4) و (3-12).

10 20 30 40 50 60 70
| | | | | | |
cs3 AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGT
GOR4 ccccccchhhhhhhcccchhhhcccccccceeccccccceeeeeeeecccccceeeeeecccccccccce
PHD ccccceeeeeeeeeeccccccccccccceeeeecccccceeeeeeeeeccccceeeeeeecccccccccc
SIMPA96 cccchhhhhhhhhhhcccccccccccccceeeecccccceeeeeeeecccccceeeeeccccccccccce
SOPM cccccchhhhhhhhcchhhhhhhcccccceeecccccchheeeeeeettcccceeeeeecccccccttte
Sec.Cons. cccccchhhhhhhhcccc????ccccccceee?cccccceeeeeeeecccccceeeeeecccccccccce

80 90 100 110 120 130 140
| | | | | | |
cs3 VTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANIT
GOR4 eeeecccccccceeeeecccccceeecccccceeeeecccccccccccceeeecccccceecccccccee
PHD cceeeeecccccccceeccccccceeeccccceeeeeccccccccccccceeeeeccecccecceeeeee
SIMPA96 eeeeecccccceeeeeeccccceeeecccccceeeeeccccccccccceeeeeccccceeecccccceee
SOPM eeeeecccccceeeeeeecccceeeeettttceeeeeettcccccccceeeeeccccceeeetccceeee
Sec.Cons. eeeeecccccc?eeeeeccccc?eee?ccccceeeeeccccccccccc?eeeeccccc?ee?cccc?eee

cs3 ITSTIK
GOR4 eeeeec
PHD eeeeec
SIMPA96 eecccc
SOPM eeeeee
Sec.Cons. eeeeec
شکل 3-12. پیشگویی پیشگویی ساختار دوم زیرواحد اصلی پیلی CstHو موقعیت نسبی مناطق مجاز بر روی آن

3-1-3 پیشگویی نهایی مناطق مجاز در زیرواحد CstH
مجموع آنالیزها و بررسیهای انجامگرفته نواحی اسیدهایآمینه 38-39، 66-67، 79-80، 92-93 و 107-108 پروتئین بالغ CstHبه عنوان مناطق محتمل مناسب ورود پپتیدهای بیگانه و بعبارتی مناطق مجاز برای ورود موتیف اتصالی به کادمیوم در نظر گرفتهشدند(شکل3-13).

شکل3-13. مدل سهبعدی CstH و موقعیت جایگاههای مجاز در آن

4-1-3 مدلسازی پروتئینهای هیبرید
خصوصیات ساختاری پروتئینهای هیبرید بخصوص از نقطهنظر صیانت ساختاری موتیفهای کادمیوم واردشده، ملکول حامل (CstH) و همچنین در معرض قرارگیری موتیف، با بهرهگیری از مدلسازی سه بعدی از ملکولهای هیبرید توسط نرمافزار Modellerمورد بررسی قرارگرفت. همچنانکه در شکل 3-14 ملاحظه میشود علاوه بر حفاظت ساختاری پروتئین حامل و پپتید وارد شده در آن، موتیف کادمیوم بخصوص دو اسیدآمینه سیستئین آن کاملا در معرض میباشند. خصوصیات استروشیمیایی مدلهای حاصل بررسی شد که امیتازات قابل قبولی را ارائه دادند به عنوان مثال امتیاز ProSA z-scoreمدل هیبرید برای موقعیت 107، 1/5- بدست آمد که این عدد در محدود پروتئینهای کریستالوگرفی شده طبیعی میباشد و همچنین بررسی نمودار راماچاندران مدل هیبرید با سرور Phrocheck، نشان داد که بیش از 90 درصد اسیدهایآمینه تاخوردگی مجاز و مرسوم را دارند. که این تائیدی بر مناسب بودن جایگاه مجاز میباشد.

شکل 3-14. مقایسه ساختاری الگوها با مدل هیبرید و آنالیز و بررسی در معرض قرارگیری موتیف متصل شونده به فلز سنگین. (A) ساختار سهبعدی بخش انتهایآمینی پروتئین CadA (B) مدل پروتئین هیبرید pEYS107cbm و (C) مدل CstH. موتیفهای اتصالی به کادمیوم به رنگ آبی تیره و سیستئین به رنگ زرد مشخص شدهاست (پانل A). مناطق در معرض به رنگ آبیتیره (شکل B) و مناطق مخفی یا آبگریز به رنگ آبی روشن نشان دادهشده است. شکل توسط نرمافزارDiscovery Studio 2.5 تهیه شدهاست

2-3 نتایج آزمایشگاهی
1-2-3 ساخت کاست های ژنی از ترکیب ژن cstH و توالی متصل شونده به کادمیوم
همچنانکه پیشتر ذکرشد توالی اسید¬آمینه موتیفهای متصلشونده به کادمیوم از پروتئین CadA استخراج گردید. و بطور جداگانه در هریک از جایگاههای مجاز با کمک SOE-PCR وارد ژن cstH شدند. شکل 3-15 توالیهای پروتئین CstH و توالی موتیف و بتاموتیف و همچنین توالی CstH جهش یافته پس از وارد کردن موتیف و بتاموتیف در جایگاه 38 را نشان میدهد. در اینجا جهت تقریب مسئله به ذهن مراحل SOE-PCR را با شکل شماتیک برای جهشزایی در جایگاه 38 نشان داده ایم. مراحل آزمایشگاهی نیز به ترتیب ذکر شده در شکل 3-13 انجام گرفت. محصول PCR شماره 2 از روی ژل بازیافت شد و به عنوان الگو برای PCR شماره 3 استفاده شد سپس محصول PCR مراحل 1و 3 از ژل بازیافت شده و به عنوان الگو برای SOE-PCR مورد استفاده قرارگرفتند. بدین ترتیب که یک واکنش گسترش انتهای با 7 سیکل روی دو محصول صورت گرفت سپس محصول نوترکیب این مرحله از واکنش با دو پرایمر انتهای ژن یعنی CS3-FF و CS3-RR تکثیر شد و محصول نهایی آنها از روی ژل بازیافت شده و جهت کلون در وکتور کلونینگ استفاده شد. جهش زایی در سایر مناطق مجاز نیز با همین روال و با آغازگرهای مربوطه انجام پذیرفت. شکلهای 3-16 الکتروفورز محصول مرحله 2و 3 و همچنین محصول نهایی SOEing-PCR برای همه جهشزایی را بر روی ژل آگارز یک درصد نشان می دهد. لازم به ذکر است نامگذاری محصولات PCR بر اساس جایگاه محل اسیدآمینه در پروتئین بالغ که قراراست جهش در آن ایجاد شود (قطعه خارجی وارد آن شود) و همچنین نوع آغازگر هیبریدی بکار گرفتهشده در PCR، انجام گرفتهاست (جدول2-8).

(A)
>CstH sequence
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITSTIK
(B)
Beta motif Sequence
VDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEA
Motif sequence
VDGLSCTNCAAKFERNVKEIEGVTEAI

(C)
CstH mutant (pEYS38m1)
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSVDGLSCTNCAAKFERNVKEIEGVTEAINTLVGVLTLSNTSIDTVSIASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITSTIK
CstH mutant (pEYS38bm1)
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEANTLVGVLTLSNTSIDTVSIASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITSTIK

(D)

شکل 3- 15. ساخت کاستهای ژنی از ترکیب ژن cstH و توالی متصلشونده به کادمیوم.(a) توالی پروتئین CstH که در آن پنج جایگاه مجاز با پسزمینه مشخص شدهاند. (b) توالی موتیف و بتاموتیف متصل شونده به فلز سنگین. (c) توالی پروتیئن جهش یافته (هیبرید CstH-Cbm وCbβm-CstH) که توالیهای موتیف و بتاموتیف با فونت پررنگتر و زیر آنها خط کشیده شدهاست. (d) مراحل SOE-PCR را برای جایگاه 38 نشان میدهد.

(A)

(B)

(C)

شکل 3 – 16. الکتروفورز محصولات SOEing-PCR. (A) و (B) الکتروفورز محصول مراحل 1 و 3 SOEing-PCR را روی ژل آگارز یک درصد را نشانمیدهد. نوشته ذیل شکل، ردیف بالا نشاندهنده نام و ردیف پایین اندازه محصول میباشد. (C) الکتروفورز محصول نهایی SOEing-PCR روی ژل آگارز یک درصد. ردیف بالا نام محصول و ردیف پایین اندازه محصول را نشان میدهد. توجه شود که به دلیل کمبود فضا در زیر شکل، کلمه cstH از ابتدای اسامی حذف شده است. به عنوان مثال اسم کامل 38m1، cstH38cbm1 میباشد که بیانگر جهش در جایگاه 38 ژن cstH میباشد و عدد یک نیز اشاره به مرحله اول ساخت کاست دارد. از مارکر DNA 100bp فرمنتاز استفاده شد.

2-2-3 کلونینگ DNA زیرواحد اصلی(CstH) جهشیافته در وکتور کلونینگ
محصول نهایی SOEing-PCRها که به ترتیب برای CstH::cbm100 و 101CstH::cbβm 738 و 780 جفتباز بودند طی واکنش اتصال در جایگاه EcoRV پلاسمید pBR322 کلون شدند (شکل 3-17). سپس محصول اتصال به باکتری E.coli DH5α که نسبت به آنتیبیوتیکهای تتراسایکلین و آمپیسیلین حساس است منتقل شدند. از آنجائیکه در ‌این روش‌ م‍ح‍ص‍ول‌ نهای‍‍ی‌ ک‍لونینگ‌ ژن‌ ش‍‍ام‍ل ن‍م‍ونه‌های متعددی ‌اس‍ت‌ که انتهای تعداد اندکی از آنها ‌حاوی ژن هدف ب‍طور ص‍ح‍ی‍ح‍‍‌ ‌میباشد.لذا غربالگری نمونههای تولید شده برای یافتن کلونیهای مطلوب جهت استفاده در ادامه کار ضرروی میباشد.

شکل 3-17. نحوه کلونینگ محصولات SOEing PCR در ناقل pBR322(نام دقیق pEYSbm ، pEYScbβm و نام دقیق pEYSm1 ،pEYScbm1) میباشد.

1-2-2-3 غربالگری کلونهای دارای پلاسمیدهای نوترکیب
1-1-2-2-3 غربالگری با مقاومت آنتیبیوتیکی و مقایسه وزنی با پلاسمیدهای کنترل
جهت بررسی مقاومت آنتیبیوتیکی کلون های حاصل، ابتدا باکتریهای تراریخت روی پلیت آگار حاوی آمپیسیلین و بدون تتراسایکلین پخش و در دمای C °37 انکوبه گردید. کلنیهای حاصل روی پلیت حاوی آمپیسیلین و تتراسایکلین کشت داده شد و کلنیهای حساس به تتراسایکلین و مقاوم به آمپیسیلین بعنوان کلنیهای حاوی پلاسمید نوترکیب برای غربالگری بیشتر انتخاب شدند. کلنیهای حساس به تتراسایکلین را کشت انبوه داده و DNA آنها پس از استخراج با DNA پلاسمید

پایان نامه
Previous Entries پایان نامه ارشد درباره مدل سازی Next Entries پایان نامه ارشد درباره پلاسمیدهای، کلونهای، (B)، ژلآگارز