تحقیق رایگان درباره Query، Sbjct، توالي

دانلود پایان نامه ارشد

ي توالي مشاهده ميشود در همرديفي ساختار دوم نيز قابل مشاهده است، خط پيوند (“-“) نشاندهنده افتادگي در يک بنيان است.(a2) ، مقايسه ساختار دوم توافقي بين الگو – هدف (ساختار دوم توافقي استخراج شده از متدهاي تعيين ساختار دوم يعنيGOR4, PHD, SIMPA96 و SOPM ميباشد): عناصر ساختار دوم پروتئين با حروف h helix, ،e ، extended، و c،coil. نشاندادهشدهاست.
(B ) تعيين ساختار دوم براي مدلهاي پيشنهادي و الگوهاي مربوطه با نرمافزار Stride و مقايسه آنها، نوار آبي رنگ = هليکسها، ميلههاي زرد رنگ =کويلها و فلشهاي سبز= استرندها.
(C ) تصاويري از مقايسه ساختاري، مناطقي که به دليل تفاوت ساختاري غيرقابل انطباق هستند با رنگ قرمز و زرد تيره به ترتيب براي مدلهاي CS3-1 و CstH نشانداده شدهاند.

Score = 164 bits (414), Expect = 4e-41, Method: Compositional matrix adjust.
Identities = 84/218 (39%), Positives = 132/218 (61%), Gaps = 11/218 (5%)

Query 3 ITTQKFEAILGATRVIYHLDGNGESLRVKNPQISPILIQSKVMDEGSKDNAD–FIVTPP 60
++++ +G +R+IY LD G + VKN Q P+LIQS++ DE + ++ F+VTPP
Sbjct 7 FASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPP 66

Query 61 LFRLDAKRETDIRIVMVNGLYPKDRESLKTLCVRGIPPKQGDLW—ANNEKEF—–V 112
LFRLDAK++ +RI G++P+D+ESLK LCV+GIPPK D+W A N+++F V
Sbjct 67 LFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDEDIWVDDATNKQKFNPDKDV 126

Query 113 GMKLNVSINTCIKLILRPHNLPKLDINSEGQIEWGIRDGNLVAKNKTPYYFTIVNASFNG 172
G+ + +IN CIKL++RP+ L I + W + G L+A+N +P+Y I +F G
Sbjct 127 GVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGG 186

Query 173 KALKTPGTLGPYEQKLYTLPSKISVSGLVKWEIIGDLG 210
K++ + + P + LP ++ + V W II D G
Sbjct 187 KSIPS-HYIPPKSTWAFDLPKGLAGARNVSWRIINDQG 223

(A)

Phyre 2

cs3
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTG-V-SNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGT-VTFAHETNNSASFAT-TISTDNANITL—— DKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITST–IK
d1p5v_b
————–VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTS-TSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLAT-GSQ—DFFVRSIGSKGGK-LAAGKYTDAVTVTVSNQ-
(B)
شکل3-5. (A) و ((B همرديفي توالي الگو و هدف زيرواحد اصلي و چاپرون دو پيلي CS3 و F1 antigen که به ترتيب توسط سرورهاي سازنده مدل يعني Swiss-M0del و Phrye2 ارائه شدهاست.

جدول 3-2. ويژگيهاي ساختاري الگو- هدف که توسط روشهاي محاسباتي به همراه امتيازات نمرهدهي بدست آمدهاست.

Query

Template

Methods

%id

Modelled reagions

Scores

CE

TM-align

Deepview

Sizef RMSD
size RMSD
size RMSD

Cs3
d1p5vb

d1p5vb
Phyre2

Fold pro
26
15-142
89%a

0.94b

114 1.0 A

مدل بررسي نشد
125 1.39 A°

مدل بررسي نشد
114 0.56 A°

مدل بررسي نشد
Cs3-1
1p5uA

1p5uA

1p5uA

Swiss-model

Blast against PDB

Psi-Blast against PDB
37.5

39

38
5 to 220
cQMEANscore4= 0.58
E-valued= 0.00e-1

E-valuee
= 4e-41

E-value

= 4e-69

205 0.9 A

مدل ارائه نشد

مدل ارائه نشد
205 1.13

مدل ارائه نشد

مدل ارائه نشد
197 0.17 A°

مدل ارائه نشد

مدل ارائه نشد
Score a امتياز بالاتر نشاندهنده اعتبار بالايي مدل ساخته شده ميباشد.
Score b: امتياز مثبت نشاندهنده انطباق معنيدار بين توالي کوئيري- الگو ميباشد.
QMEANscore4c <1 <1: از درجه اعتماد بالايي برخورداراست.
E-valued <001/.: بسيار معنيدار و مطمئن
E-value e: هر جه پايين تر باشد قابل اطمينانتر است.
Size f: نشاندهنده تعداد موقعيتهايي که همرديف شدند.

2-2-1-3 توليد و ساخت مدل و ارزيابي کيفيت آنها
ترکيبي از همرديفي ساختارهاي اول، دوم و سوم براي مدلسازي ساختارهاي CstH و CS3-1 استفادهشد. ساختارهاي سوم Caf1 (PDB id 1p5v; chainb) و Caf1M (PDB id 1p5u; chainA) به عنوان مناسبترين ( پربرخوردترين الگو) الگو براي مدلسازي دو پروتئين به ترتيبCstH و CS3-1 توسط سرورهاي مختلف ارائه شدند و مدلهاي ساخته شده (شکل 3-6) براي دو ملکولCstH و CS3-1، در شرايط ديناميک ملکولي با نرم افزار گرومکس در دماي 300 درجه کلوين و فشار يک بار براي 23 نانوثانيه شبيهسازي شدند همچنانکه در شکل 3-7 ملاحظه ميشود ملکول چاپرون پايداري مطلوبي بعد از 23 نانوثانيه بدستآوردهاست ولي ملکولCstH داراي آشفتگي در انتهايآميني خود ميباشد.
لذا مدلهاي حاصل از روشهاي استاتيک جهت تائيد بيشتر توسط نرمافزارها و ابزارهاي ارزيابي مانند سرورهاي,Veryfy3D, Qmean ,Prosa-web TM-Scoreو نمودار راماچاندران مورد ارزيابي قرارگرفتند.

شکل .3-6. مدلهاي توليد شده براي دو پروتئين CstH (سمت چپ) و CS3-1 (سمت راست) به ترتيب با Alignment – Mode Swiss-Model و Modeler.

شکل 3-7. ارزيابي پايداري دو ملکول CstH وCS3-1 در طي شبيهسازي ديناميک ملکولي. (A) RMSF97 براي ملکول CstH و (B) RMSD براي ملکول CS3-1

امتياز حاصل از سرور Verify3D براي مدل CstH (d1p5vb) بيشتر از صفر ميباشد و براي مدل CS3-1 امتياز در مناطق کوچکي زير صفر افت پيدا ميکند (100-113) که اين مناطق هم از لحاظ سرهمبندي زيرواحدهاي پيلي نقش چندان کليدي ندارد و بررسي بيشتر با ساير ابزارها براي پاسخگويي و رفع اين نقيصه انجام گرفت .
بررسي نمودار راماچاندران نشان داد که به ترتيب 82% و 92% اسيدهايآمينه مدل براي CstH و CS3-1 در منطقه بسيار مطلوب قرار دارند (شکل3-8) که نشاندهنده صحت مدلهاي توليد شده ميباشد.
آناليز مدل هاي CstH و CS3-1 بوسيله سرور Qmean امتيازات 42/.و658/.را نشانداد و Z-score سرور تحت شبکه Prosa به ترتيب 65/2-و 86/4- ميباشد که اين امتياز در محدوده NMR و آرايشهاي طبيعي ميباشد و بدين ترتيب تائيدي بر مدلهاي ارائه شده ميباشد(جدول 3-2).

(a1) (a2)
(a)

(b1) (b2)
(b)

شکل 3-8. (a) بررسي کيفيت مدلهاي (a1 و a2) CstH و (b و d) cs3-1توسط سرور تحت شبکه Prosa و(b) نقشه راماچاندران با سرور Procheck، همچنانکه نتيجه بررسي در سرور Prosa نشان ميدهد مدلهاي حاصل ازلحاظ کيفيت ساختاري هم سطح با ساختارهاي تعيين شده با NMR ميباشند و همچنين نقشه راماچاندران حاصل حاکي از کيفيت بالاي مدل توليد شده براي cs3-1(b1) و کيفيت قابل قبول مدل(b2) CstH ميباشد.

پس از پيشگويي ساختارهاي سوم زيرواحد اصلي و چاپرون پيلي CS3 آناليز و بررسيهاي بيشتري بر روي مدلCstH جهت پيشگويي و يافتن جايگاههاي مجاز انجام گرفت که ادامه مراحل و نتايج آن بشرح زير ميباشد.

3-2-1-3 سطوح قابل دسترس و اسيدهايآمينه سطحي
علم و آگاهي بر مناطق سطحي ودر دسترس ((98ASA پروتيئن بعبارت ديگر اسيدهايآمينه در دسترس حلال در مکانيابي کانديد جايگاههاي مجاز از اهميت بالاي برخورداراست. ابزارهاي متعددي جهت پيشگويي و تعيين ASAبر اساس تواليهاي اوليه و ساختارهاي سوم توسعه يافته است. ابزار prot-scale در وب سايت expasy با پنجره کوچک به طول 9 اسيدآمينه، گرافي را براساس آب دوستي Kyte & Doolittle براي ساختار اوليه CstH نشانداد که چندين جايگاه به عنوان کانديداي جايگاه مجاز انتخاب شدند (شکل 3-9).

شکل 3-9. کانديداهاي جايگاههاي مجاز. جايگاههايي که اميتاز آنها کمتر از 0 ميباشد بعنوان کانديد جايگاه مجاز ميباشند، موقعيتهاي که در اين مطالعه به عنوان جايگاه مجاز انتخاب شدند با بيضيهاي سياه رنگ نشان داده شدهاست.

براي افزايش سنديت و اعتبار نتايج، کيفيت پيشگويي مناطق سطحي و در دسترس با کمک نرمافزار Discovery Studio و برنامه هايGetarea و Vadarمورد ارزيابي قرار گرفتند. برنامههاي فوق مناطق پنهان، در معرض قطبي و باردار را ارائه ميکنند همچنانکه در شکل 3-10 ملاحظه ميشود بخش بزرگي از ملکول در دسترس حلال بعبارتي در معرض قرار ميگيرند. در آناليز بابرنامههايGetarea و Vadarمناطقي که ميزان در سطح قرار گيري آنها بيش از 50 درصد بدست آمدند بعنوان مناطق در دسترس (ASA) و جايگاههاي مجاز احتمالي در نظر گرفتهشدند. مقايسه مناطق فوق با مناطقي که در بررسي آب دوستي پروتئين به عنوان کانديد جايگاهمجاز در نظر گرفتهشدهبود نشان ميدهد که اين نواحي بر يکديگر منبطق هستند (شکل 3-11).

شکل 3-10. آناليز در معرض قرارگيري مدل CstH با کمک نرمافزارDiscovery Studio 2.5. مناطق در معرض با رنگ سياه و مناطق مخفي با رنگ زرد نمايش دادهشدهاست.

شکل 3-11. آناليز مدل CstH با سرور VADAR. جايگاههاي مجاز با پيکان نمايش دادهشدهاست.

4-2-1-3 سطوح مشترک و اسيدهايآمينه درگير در ارتباطات زيرواحدها در پليمر پيلي و زيرواحد-چاپرون
پيلي باکتريايي پليمري است که از زيرواحدهاي يکسان تشکيل شدهاست که طي مراحل اسمبلي يا سرهم شدن به صورت يک به يک به پليمر اضافه شده تا پليمر پيلي که حدود 500 زيرواحد دارد تشکيلشود. زير واحدهاي پيلي قبل از اينکه وارد پليمر شوند، کمپلکسهاي موقتي با چاپرون در پريپلاسم تشکيل ميدهند. سپس طي فرايند سرهم شدن و تشکيل پليمر، چاپرون با زيرواحد جابجا ميگردد (شکل 1-7). بنابراين بنظر ميرسد مناطق درگير در فرايند اسمبلي پيلي و نيز مناطق در ارتباط با اتصال زيرواحد-چاپرون ميبايست مشخص شده تا از دستکاري ژنتيکي استثنا شوند. در اينجا با بکارگيري سه روش زير، توالي هاي درگير در ارتباطات و اتصالات پيشگويي شدند (جدول3-3).
(a): دو سرور پيشگويي برهم کنش پروتئين-پروتئين يعني Pcons-PPISP و Meta-PPISP جهت پيشگويي بنيانهاي درگير در اتصالات بر اساس مدل CstH استفاده شدند و نتايج حاصل حاکي از اين است که جايگاههاي پيشنهاد شده جهت پذيرش پپتيد بيگانه (جايگاههاي مجاز) در واکنش پروتئين- پروتيئن شرکت نميکنند(پيوست هفت).
( B): در روش دوم، مناطق مرتبط از طريق دياگرام برهمکنش پروتئين-پروتئين موجود در PDBsum براي وروديهاي 1p5v و 1p5u استخراج شد و موقعيت نسبي آنها بر روي پروتئينهاي CstH و CS3-1 بعنوان مناطق احتمالي درگير در اتصالات ملکولي از دستورزي مستثني شدند. آدرس دسترسي به محلهاي درگير در اتصالات ملکولي دو پروتئين Caf1 و Caf1M (به ترتيب الگوهاي CstH وCS3-1) به شرح زيراست.
http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetIface.pl?pdb=1p5v&chain1=A&chain2=B
(c ): از آنجائيکه دو سيستم CS3 و Caf شباهت زيادي با هم دارند بنابراين بنظر ميرسد که آناليز و بررسي سيستم Caf از نقطه نظر اسيدهايآمينه درگير در اتصالات ميتواند به سيستم CS3 نيز تعميم دادهشود. بنابراين اسيدهايآمينه درگير درهمودايمر(Caf1::Caf1) و هترودايمر (Caf1::Caf1M) سيستم Caf با کمک محاسبه ميزان تغيير در مناطق قابل دسترس (?ASA) از حالت منومري نسبت به حالت دايمري با کمک سرور Getarea ارزيابيشد و اسيدهايآمينه با ?ASA <0 ? به عنوان بنيانهاي درگير در اتصالات در نظر گرفتهشدند (دادهها نمايش داده نشدند).
و بدين ترتيب، بنيان هاي در ارتباط بين زيرواحد-زيرواحد و زيرواحد-چاپرون پيشگويي شدند و براساس اين نتايج حدود 25 اسيدآمينه از ابتدا و انتهاي زيرواحد و تعداد کمي در طول پروتئين CS3 در اين ارتباطات درگير ميباشند و از دستکاري ژنتيکي کنارگذاشته شدند.

جدول 3-3. مناطق و اسيدهايآمينه درگير در ارتباطات ملکولي و غيرقابل دسترس ملکول CstH

5-2-1-3 پيشگويي و تعيين ساختار دوم
ساختارهاي دوم و نيز ساختار دوم توافقي توالي زيرواحد اصلي پيليCS3 (جدول شماره 1) با نرمافزارهاي مختلفي که در بخش مواد و روشها به آنها اشاره شد، پيشگويي گرديد.
روش هاي پيشگويي ساختار دوم بخصوص زماني که همراه با ديگر روش هاي آناليز بکار ميروند، بسيار مفيد ميباشند، به عنوان مثال در مواردي که الگوهاي پيشگويي شده از لحاظ توالي، تشابه کمتري باهم دارند در اين مواقع پيشگويي ساختار دوم مي تواند در گزينش الگوي مناسب که داراي ساختار مشابه با پروتئين هدف مي¬باشد کمک کند.
از طرف ديگر تصور مي‌شود نواحي در معرض محيط99 و آب دوست که ساختار کويل نيز دارند کانديداي مناسبي‌، براي مناطق مجاز و وارد کردن پپتيدهاي بيگانه جهت عرضه سطحي هستند. (,Hedegaard.1989 Macdonald.2001، chlehuber.2004 و Sujatha.2006). لذا ساختار دوم پروتئين CstH توسط نرمافزارهاي پيشگويي و نرم افزارهاي تعيين ساختار دوم به ترتيب از ساختار اوليه و مدل CstH جهت بدست آوردن مناطق داراي آرايش کويل مورد بررسي قرار گرفتند( شکلهاي 3-4) و (3-12).

10 20 30 40 50 60 70
| | | | | | |
cs3 AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGT
GOR4 ccccccchhhhhhhcccchhhhcccccccceeccccccceeeeeeeecccccceeeeeecccccccccce
PHD ccccceeeeeeeeeeccccccccccccceeeeecccccceeeeeeeeeccccceeeeeeecccccccccc
SIMPA96 cccchhhhhhhhhhhcccccccccccccceeeecccccceeeeeeeecccccceeeeeccccccccccce
SOPM cccccchhhhhhhhcchhhhhhhcccccceeecccccchheeeeeeettcccceeeeeecccccccttte
Sec.Cons. cccccchhhhhhhhcccc????ccccccceee?cccccceeeeeeeecccccceeeeeecccccccccce

80 90 100 110 120 130 140
| | | | | | |
cs3 VTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANIT
GOR4 eeeecccccccceeeeecccccceeecccccceeeeecccccccccccceeeecccccceecccccccee
PHD cceeeeecccccccceeccccccceeeccccceeeeeccccccccccccceeeeeccecccecceeeeee
SIMPA96 eeeeecccccceeeeeeccccceeeecccccceeeeeccccccccccceeeeeccccceeecccccceee
SOPM eeeeecccccceeeeeeecccceeeeettttceeeeeettcccccccceeeeeccccceeeetccceeee
Sec.Cons. eeeeecccccc?eeeeeccccc?eee?ccccceeeeeccccccccccc?eeeeccccc?ee?cccc?eee

cs3 ITSTIK
GOR4 eeeeec
PHD eeeeec
SIMPA96 eecccc
SOPM eeeeee
Sec.Cons. eeeeec
شکل 3-12. پيشگويي پيشگويي ساختار دوم زيرواحد اصلي پيلي CstHو موقعيت نسبي مناطق مجاز بر روي آن

3-1-3 پيشگويي نهايي مناطق مجاز در زيرواحد CstH
مجموع آناليزها و بررسيهاي انجامگرفته نواحي اسيدهايآمينه 38-39، 66-67، 79-80، 92-93 و 107-108 پروتئين بالغ CstHبه عنوان مناطق محتمل مناسب ورود پپتيدهاي بيگانه و بعبارتي مناطق مجاز براي ورود موتيف اتصالي به کادميوم در نظر گرفتهشدند(شکل3-13).

شکل3-13. مدل سهبعدي CstH و موقعيت جايگاههاي مجاز در آن

4-1-3 مدلسازي پروتئينهاي هيبريد
خصوصيات ساختاري پروتئينهاي هيبريد بخصوص از نقطهنظر صيانت ساختاري موتيفهاي کادميوم واردشده، ملکول حامل (CstH) و همچنين در معرض قرارگيري موتيف، با بهرهگيري از مدلسازي سه بعدي از ملکولهاي هيبريد توسط نرمافزار Modellerمورد بررسي قرارگرفت. همچنانکه در شکل 3-14 ملاحظه ميشود علاوه بر حفاظت ساختاري پروتئين حامل و پپتيد وارد شده در آن، موتيف کادميوم بخصوص دو اسيدآمينه سيستئين آن کاملا در معرض ميباشند. خصوصيات استروشيميايي مدلهاي حاصل بررسي شد که اميتازات قابل قبولي را ارائه دادند به عنوان مثال امتياز ProSA z-scoreمدل هيبريد براي موقعيت 107، 1/5- بدست آمد که اين عدد در محدود پروتئينهاي کريستالوگرفي شده طبيعي ميباشد و همچنين بررسي نمودار راماچاندران مدل هيبريد با سرور Phrocheck، نشان داد که بيش از 90 درصد اسيدهايآمينه تاخوردگي مجاز و مرسوم را دارند. که اين تائيدي بر مناسب بودن جايگاه مجاز ميباشد.

شکل 3-14. مقايسه ساختاري الگوها با مدل هيبريد و آناليز و بررسي در معرض قرارگيري موتيف متصل شونده به فلز سنگين. (A) ساختار سهبعدي بخش انتهايآميني پروتئين CadA (B) مدل پروتئين هيبريد pEYS107cbm و (C) مدل CstH. موتيفهاي اتصالي به کادميوم به رنگ آبي تيره و سيستئين به رنگ زرد مشخص شدهاست (پانل A). مناطق در معرض به رنگ آبيتيره (شکل B) و مناطق مخفي يا آبگريز به رنگ آبي روشن نشان دادهشده است. شکل توسط نرمافزارDiscovery Studio 2.5 تهيه شدهاست

2-3 نتايج آزمايشگاهي
1-2-3 ساخت کاست هاي ژني از ترکيب ژن cstH و توالي متصل شونده به کادميوم
همچنانکه پيشتر ذکرشد توالي اسيد¬آمينه موتيفهاي متصلشونده به کادميوم از پروتئين CadA استخراج گرديد. و بطور جداگانه در هريک از جايگاههاي مجاز با کمک SOE-PCR وارد ژن cstH شدند. شکل 3-15 تواليهاي پروتئين CstH و توالي موتيف و بتاموتيف و همچنين توالي CstH جهش يافته پس از وارد کردن موتيف و بتاموتيف در جايگاه 38 را نشان ميدهد. در اينجا جهت تقريب مسئله به ذهن مراحل SOE-PCR را با شکل شماتيک براي جهشزايي در جايگاه 38 نشان داده ايم. مراحل آزمايشگاهي نيز به ترتيب ذکر شده در شکل 3-13 انجام گرفت. محصول PCR شماره 2 از روي ژل بازيافت شد و به عنوان الگو براي PCR شماره 3 استفاده شد سپس محصول PCR مراحل 1و 3 از ژل بازيافت شده و به عنوان الگو براي SOE-PCR مورد استفاده قرارگرفتند. بدين ترتيب که يک واکنش گسترش انتهاي با 7 سيکل روي دو محصول صورت گرفت سپس محصول نوترکيب اين مرحله از واکنش با دو پرايمر انتهاي ژن يعني CS3-FF و CS3-RR تکثير شد و محصول نهايي آنها از روي ژل بازيافت شده و جهت کلون در وکتور کلونينگ استفاده شد. جهش زايي در ساير مناطق مجاز نيز با همين روال و با آغازگرهاي مربوطه انجام پذيرفت. شکلهاي 3-16 الکتروفورز محصول مرحله 2و 3 و همچنين محصول نهايي SOEing-PCR براي همه جهشزايي را بر روي ژل آگارز يک درصد نشان مي دهد. لازم به ذکر است نامگذاري محصولات PCR بر اساس جايگاه محل اسيدآمينه در پروتئين بالغ که قراراست جهش در آن ايجاد شود (قطعه خارجي وارد آن شود) و همچنين نوع آغازگر هيبريدي بکار گرفتهشده در PCR، انجام گرفتهاست (جدول2-8).

(A)
>CstH sequence
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSNTLVGVLTLSNTSIDTVSIASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITSTIK
(B)
Beta motif Sequence
VDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEA
Motif sequence
VDGLSCTNCAAKFERNVKEIEGVTEAI

(C)
CstH mutant (pEYS38m1)
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSVDGLSCTNCAAKFERNVKEIEGVTEAINTLVGVLTLSNTSIDTVSIASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITSTIK
CstH mutant (pEYS38bm1)
AAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEANTLVGVLTLSNTSIDTVSIASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGNYRANITITSTIK

(D)

شکل 3- 15. ساخت کاستهاي ژني از ترکيب ژن cstH و توالي متصلشونده به کادميوم.(a) توالي پروتئين CstH که در آن پنج جايگاه مجاز با پسزمينه مشخص شدهاند. (b) توالي موتيف و بتاموتيف متصل شونده به فلز سنگين. (c) توالي پروتيئن جهش يافته (هيبريد CstH-Cbm وCb?m-CstH) که تواليهاي موتيف و بتاموتيف با فونت پررنگتر و زير آنها خط کشيده شدهاست. (d) مراحل SOE-PCR را براي جايگاه 38 نشان ميدهد.

(A)

(B)

(C)

شکل 3 – 16. الکتروفورز محصولات SOEing-PCR. (A) و (B) الکتروفورز محصول مراحل 1 و 3 SOEing-PCR را روي ژل آگارز يک درصد را نشانميدهد. نوشته ذيل شکل، رديف بالا نشاندهنده نام و رديف پايين اندازه محصول ميباشد. (C) الکتروفورز محصول نهايي SOEing-PCR روي ژل آگارز يک درصد. رديف بالا نام محصول و رديف پايين اندازه محصول را نشان ميدهد. توجه شود که به دليل کمبود فضا در زير شکل، کلمه cstH از ابتداي اسامي حذف شده است. به عنوان مثال اسم کامل 38m1، cstH38cbm1 ميباشد که بيانگر جهش در جايگاه 38 ژن cstH ميباشد و عدد يک نيز اشاره به مرحله اول ساخت کاست دارد. از مارکر DNA 100bp فرمنتاز استفاده شد.

2-2-3 کلونينگ DNA زيرواحد اصلي(CstH) جهشيافته در وکتور کلونينگ
محصول نهايي SOEing-PCRها که به ترتيب براي CstH::cbm100 و 101CstH::cb?m 738 و 780 جفتباز بودند طي واکنش اتصال در جايگاه EcoRV پلاسميد pBR322 کلون شدند (شکل 3-17). سپس محصول اتصال به باکتري E.coli DH5? که نسبت به آنتيبيوتيکهاي تتراسايکلين و آمپيسيلين حساس است منتقل شدند. از آنجائيکه در ‌اين روش‌ م‍ح‍ص‍ول‌ نهاي‍‍ي‌ ک‍لونينگ‌ ژن‌ ش‍‍ام‍ل ن‍م‍ونه‌هاي متعددي ‌اس‍ت‌ که انتهاي تعداد اندکي از آنها ‌حاوي ژن هدف ب‍طور ص‍ح‍ي‍ح‍‍‌ ‌ميباشد.لذا غربالگري نمونههاي توليد شده براي يافتن کلونيهاي مطلوب جهت استفاده در ادامه کار ضرروي ميباشد.

شکل 3-17. نحوه کلونينگ محصولات SOEing PCR در ناقل pBR322(نام دقيق pEYSbm ، pEYScb?m و نام دقيق pEYSm1 ،pEYScbm1) ميباشد.

1-2-2-3 غربالگري کلونهاي داراي پلاسميدهاي نوترکيب
1-1-2-2-3 غربالگري با مقاومت آنتيبيوتيکي و مقايسه وزني با پلاسميدهاي کنترل
جهت بررسي مقاومت آنتيبيوتيکي کلون هاي حاصل، ابتدا باکتريهاي تراريخت روي پليت آگار حاوي آمپيسيلين و بدون تتراسايکلين پخش و در دماي C °37 انکوبه گرديد. کلنيهاي حاصل روي پليت حاوي آمپيسيلين و تتراسايکلين کشت داده شد و کلنيهاي حساس به تتراسايکلين و مقاوم به آمپيسيلين بعنوان کلنيهاي حاوي پلاسميد نوترکيب براي غربالگري بيشتر انتخاب شدند. کلنيهاي حساس به تتراسايکلين را کشت انبوه داده و DNA آنها پس از استخراج با DNA پلاسميد غيرنوترکيب مقايسه شدند (شکل3-18) و پلاسميدهاي که وزن ملکولي بيشتري نسبت به کنترل داشتند به عنوان کلنيهاي مثبت براي غربالگريهاي بيشتر انتخاب شدند.

شکل 3-18. الکتروفورز DNA پلاسميد pBR322 و کلونهاي نوترکيب بر روي ژل آگارز يک درصد. چاهک اول در سمت چپ در هر دو ژل پلاسميد برش نيافته pBR322 ميباشد و چاهکهاي بعدي در ژل اول از سمت چپ، کلونهاي نوترکيب حاوي ژن cstH::cbm و در ژل دوم کلونهاي نوترکيب cstH::cb?m برش نيافته ميباشد (نام دقيق pEYSm1 ، pEYScbm1 و نام دقيق pEYSmb1 ،pEYScb?m1).
2-1-2-2-3 غربالگري با PCR
کلنيهاي نوترکيب انتخاب شده ابتدا با استفاده از آغازگر پيشرو (CS3-FF) ومعکوس ((CS3-RR PCR شدند و محصول اين مرحله از PCR روي ژلآگارز يک درصد الکتروفورز گرديد (شکل 3-19) سپس نمونههاي مثبت جهشيافته دارنده ژن موتيف (cstH::cbm) با آغازگرهاي داخل(-R ) و ابتداي ژن (CS3-FF) و ژن بتا موتيف(cstH::cb?m) با آغازگرهاي داخل(-F) و انتهاي ژن ) (CS3-RR بررسي شدند. محصول PCR اين مرحله نيز روي ژلآگارز يک درصد الکتروفورز گرديد و باندهاي حاصل با اندازههاي مورد انتظار مقايسهشدند که نتيجه نشاندهنده صحت اندازه باندها ميباشد.

(A)

(B)

شکل 3- 19.الکتروفورز محصولات PCR کلونهاي نوترکيب. (A) الکتروفورز محصول واکنش PCR با آغازگرهاي ابتدا و انتهاي ژن روي ژلآگارز يک درصد.رديف بالا نام نمونه و رديف پايين اندازه آنرا نشان ميدهد. به علت کمبود فضا حروف pEYS ازابتداي نام نمونه ها حذف شده است بدين معني که نام کامل نمونه 38m1، pEYS38cbm1 و نام کامل نمونه 38cb?m1، pEYS38cb?m1 ميباشد (به شکل 3-17 پلاسميد رجوع شود). از مارکر DNA 100bp فرمنتاز استفاده شد. (B) الکتروفورز محصول واکنش PCR. سمت چپ با آغازگر داخلي (-R) و آغازگر ابتداي ژن، سمت راست، آغازگر داخلي (-F) و آغازگر انتهاي ژن . دراين ژل از مارکر DNA 1kb فرمنتاز استفاده شد. سيستم نامگذاري در شکل (B) مشابه شکل (A) مي¬باشد.

3-1-2-2-3 برش آنزيمي
به جهت اينکه در غربالگري با روش PCR آغازگرهاي وکتور در دسترس نبود و از طرف ديگربه جهت اينکه جايگاه برش آنزيمي E.coRV صاف يا بلانت مي¬باشد و انتهاي محصولات حاصل از PCR با آنزيمPfu نيزصاف مي¬باشد لذا قطعه کلون شده در جايگاه برش آنزيمي E.coRV وکتور pBR322 ممکن است در دو جهت مختلف صورت گيرد که فقط کلونينگ در يکي از اين جهت براي ادامه کار مطلوب بود. از اينرو تعيين جهت DNA ورودي در اينجا بسيار ضروري مي¬باشد.
پلاسميدهاي نوترکيب مثبت حاصل از مراحل غربالگري پس از استخراج با کيت استخراج DNA، تحت برش آنزيمي دو آنزيم BamH1 و Aoc1 قرار گرفتند و روي ژل آگارز الکتروفورز باندهاي حاصل از برش بررسي شدند. نمونههايي که دو باند 396 و 4745 ويا 396 و 4703 روي ژل نشاندادند به عنوان کلنيهاي با جهت صحيح براي بررسي مرحله بعدي انتخاب شدند(شکل 3-20).

شکل 3-20. الکتروفورز محصول برش آنزيمي DNA نوترکيب با آنزيم هاي AocIو. BamH1 نمونههاي که باند 396 به همراه باند حدود 4700 را نشان دادند به عنوان کلني هاي دارنده ژن جهش يافته در جهت مناسب، براي ادامهکار انتخاب شدند. سيستم نامگذاري نيز در اينجا همانند شکلهاي پيشين ميباشد. در ژل سمت چپ از مارکر وزن ملکولي 100bp و در ژل سمت راست از مارکر وزن ملکولي 1Kbاستفاده شدهاست . (وضوح باند پاييني در پرينت برخي از شکل ها ممکن است چندان مطلوب نباشد ولي بوضوح در فايل کامپيوتري قابل روئيت است)

4-1-2-2-3 تعيين توالي ژنهايCstH::cbm وCstH::cb?m در کلونهاي نوترکيب
پس از تائيد هاي اوليه مانند واکنش PCRو برش آنزيمي معمولا تعيين توالي به عنوان مرحله نهايي تأئيد انجام مي گيرد. جهت تاييد نهايي صحت سازههايcstH::cbm وcstH::cb?m (در جايگاه هاي مختلف ژن cstH) از تعيين توالي ژن کلون شده استفاده گرديد. بدين منظور باکتري هاي حاوي پلاسميد نوترکيب کشت داده شد سپس DNA پلاسميدهاي نوترکيب به کمک کيت (High pure plasmid Isolation Kit) استخراج و با روش Dideoxy Termination تعيين توالي شدند. پس از تعيين ترادف، تواليهاي فوق با استفاده از نرمافزار Chromas مورد بررسي قرار گرفتند و صحت توالي ژنهاي هيبريد تائيدشد. نتايج

پایان نامه
Previous Entries تحقیق رایگان درباره توالي، Sec.Cons.، سيستم Next Entries پایان نامه با واژه های کلیدی هدف گذاری، انرژی مصرفی، نرخ بهره